PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.U4ZBC
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family G2-like
Protein Properties Length: 256aa    MW: 27847.2 Da    PI: 9.2851
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.U4ZBCgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like105.92.3e-3348102155
      G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                  k+rlrWt++LH+rFv+a++qLGG+++AtPk +l++m+v+gLt++hvkSHLQkYRl
  Araip.U4ZBC  48 KQRLRWTSDLHDRFVDAITQLGGPDRATPKGVLRVMGVPGLTIYHVKSHLQKYRL 102
                  79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.00845105IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.6E-3247103IPR009057Homeodomain-like
TIGRFAMsTIGR015573.9E-2648103IPR006447Myb domain, plants
SuperFamilySSF466893.4E-1748102IPR009057Homeodomain-like
PfamPF002491.3E-750101IPR001005SANT/Myb domain
PfamPF143795.8E-24137182IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 256 aa     Download sequence    Send to blast
MYHAKKFSSA TMVPHKPQGG GEQVGNVGVL DGSAVRNAGP ASSGGNGKQR LRWTSDLHDR  60
FVDAITQLGG PDRATPKGVL RVMGVPGLTI YHVKSHLQKY RLAKYLPDSP ADGKDSKDEK  120
RTPGDTVTGI DSSQGLQIND ALRMQMEVQK RLHEQLEVQK QLQMRIEAQG KYLQKIIEEQ  180
QKLGSTLTNS DTLPLSHDKQ NNPPSEPSGS SDAIADSMSP LKKQRIDDGS KDGFAVSQVT  240
TKTSQKTDCS VDQLDS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016161873.10.0PREDICTED: protein PHR1-LIKE 1-like isoform X1
SwissprotQ8GUN52e-51PHL1_ARATH; Protein PHR1-LIKE 1
TrEMBLA0A151TAH91e-151A0A151TAH9_CAJCA; Myb family transcription factor APL
STRINGGLYMA19G30220.11e-145(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF130132330
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01060.15e-76G2-like family protein